PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 265aa    MW: 29961.9 Da    PI: 7.2807
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27214.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH12.20.000331692002455
                 HCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH  24 rellPkaskapskKlsKaeiLekAveYIksLq 55 
                  e++P+   ++ kK + a++L++A  YIk Lq
  KHN27214.1 169 SEIIPPHKVTKIKKTDTASVLQEASLYIKLLQ 200
                 589999668999*****************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
GANLPNMSEA SSYSIDIAKM RNALLSSVSS RFNCYGNDEA QFEILEGSMH MNDLIDFHIN  60
GFNMESRIFN NYSQLGQGVH TQPSQSQSLI YDYNHYPGSL FAIPSSKEIS QQSLLLDKDP  120
SQYEGVCGNA RKRPFEYTDN MSLWKKVKSN SKSKITIMEP KWHQAKEVSE IIPPHKVTKI  180
KKTDTASVLQ EASLYIKLLQ AQIRTLFQML SFTYFSTIND PHTQECADKL EVDLRSRGLC  240
LVPISITDKI TKVDQIHHAS ASINT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150372e-34AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006574862.10.0PREDICTED: transcription factor bHLH110-like isoform X2
TrEMBLA0A0B2R4V00.0A0A0B2R4V0_GLYSO; Transcription factor bHLH110 (Fragment)
STRINGGLYMA02G10420.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133551522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27660.14e-11bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]